Edit |   |
---|---|
Antigenic Specificity | TrkA/NTRK1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 ug, 10 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | TrkA/NTRK1 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence of human TrkA (EVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVL). |
Other Names | High affinity nerve growth factor receptor |
Gene, Accession # | UniProt: P04629 |
Catalog # | orb412961 |
Price | $520 |
Order / More Info | TrkA/NTRK1 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558