Edit |   |
---|---|
Antigenic Specificity | FKBP1A / FKBP12 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 50 ul |
Concentration | n/a |
Applications | IHC, IHC-P, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | FKBP1A / FKBP12 Antibody |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human FKBP1A (NP_463460.1). MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |
Other Names | FKBP1A, 12 kDa FKBP, 12 kDa FK506-binding protein, Calstabin-1, FK506 binding protein12, Fk506-binding protein, FKBP12C, FK506-binding protein 12, FKBP-1A, Immunophilin FKBP12, FK506-binding protein 1, FKBP1, FKBP12-Exip3, PKC12, PKCI2, PPIase FKBP1A, Protein kinase C inhibitor 2, Rotamase, PPIase, FK506-binding protein 1A, FKBP-12 |
Gene, Accession # | n/a |
Catalog # | orb1536415 |
Price | $635 |
Order / More Info | FKBP1A / FKBP12 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558