Edit |   |
---|---|
Antigenic Specificity | AREB6/ZEB1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 ug, 10 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | FC, ICC, IF, IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | AREB6/ZEB1 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence of human ZEB1 (LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ). |
Other Names | Zinc finger E-box-binding homeobox 1; NIL-2-A zinc finger protein; Negative regulator of IL2; Transcription factor 8; TCF-8; ZEB1; AREB6; TCF8 |
Gene, Accession # | UniProt: P37275 |
Catalog # | orb570306 |
Price | $520 |
Order / More Info | AREB6/ZEB1 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558