Edit |   |
---|---|
Antigenic Specificity | E3 SUMO-protein ligase PIAS4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | E3 SUMO-protein ligase PIAS4 Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human PIAS4 (130-174aa EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE), different from the related mouse sequence by two amino acids. |
Other Names | E3 SUMO-protein ligase PIAS4;6.3.2.-;PIASy;Protein inhibitor of activated STAT protein 4;Protein inhibitor of activated STAT protein gamma;PIAS-gamma;PIAS4;PIASG; |
Gene, Accession # | UniProt: Q8N2W9 |
Catalog # | orb381084 |
Price | $268 |
Order / More Info | E3 SUMO-protein ligase PIAS4 Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558