Edit |   |
---|---|
Antigenic Specificity | TNF alpha |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | FC, IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | TNF alpha Antibody |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human TNF (201-233aa QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL), different from the related mouse sequence by five amino acids, and rat sequence by seven amino acids. |
Other Names | Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2; TNF-a; Tumor necrosis factor, membrane form; N-terminal fragment; NTF; Intracellular domain 1; ICD1; Intracellular domain 2; ICD2; C-domain 1; C-domain 2; Tumor necrosis factor, soluble form; TNF; TNFA; TNFSF2 |
Gene, Accession # | UniProt: P01375 |
Catalog # | orb526980 |
Price | $268 |
Order / More Info | TNF alpha Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558