EpCAM Antibody from BIORBYT LTD.
Search, find, compare suppliers for anti-EpCAM antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | EpCAM |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | unconjugated |
| Size | 10 ug, 100 ug |
| Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
| Applications | ELISA, FC, IF, IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | EpCAM Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen ami |
| Other Names | Epithelial cell adhesion molecule;Ep-CAM;Adenocarcinoma-associated antigen;Cell surface glycoprotein Trop-1;Epithelial cell surface antigen;Epithelial glycoprotein;EGP;Epithelial glycoprotein 314;EGP314;hEGP314;KS 1/4 antigen;KSA;Major gastrointestinal tumor-associated protein GA733-2;Tumor-associated calcium signal transducer 1;CD326;EPCAM;GA733-2, M1S2, M4S1, MIC18, TACSTD1, TROP1; |
| Gene, Accession # | UniProt: P16422 |
| Catalog # | orb381061 |
| Price | $268 |
| Order / More Info | EpCAM Antibody from BIORBYT LTD. |
| Product Specific References | n/a |
BIORBYT LTD.
BIORBYT LTD.
7 Signet Court
Swann Road
Cambridge, CB5 8LA U.K.
P: +44 (0)1223 859 353
F: +44(0)1223 280 240
info@biorbyt.com
http://www.biorbyt.com
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558
Profile of BIORBYT LTD.
Return to Antibodies