Edit |   |
---|---|
Antigenic Specificity | VWF / Von Willebrand Factor |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 50 ul |
Concentration | n/a |
Applications | IHC, IHC-P, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | VWF / Von Willebrand Factor Antibody |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human VWF (NP_000543.2). MYSFAGYCSYLLAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLL |
Other Names | VWF, Coagulation factor VIII VWF, F8VWF, VWD, Von Willebrand factor, factor VIII-related antigen, Factor VIII-R, Factor VIII-R Ag, VIII R AG |
Gene, Accession # | n/a |
Catalog # | orb1536619 |
Price | $635 |
Order / More Info | VWF / Von Willebrand Factor Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558