Edit |   |
---|---|
Antigenic Specificity | Beta Tubulin |
Clone | monoclonal |
Host Species | Mouse |
Reactive Species | human, mouse, rat |
Isotype | IgG1 |
Format | unconjugated |
Size | 10 ug, 100 ug |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
Applications | FC, ICC, IF, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Beta Tubulin Antibody(monoclonal, 5E4) |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences. |
Other Names | n/a |
Gene, Accession # | UniProt: P07437 |
Catalog # | orb623835 |
Price | $268 |
Order / More Info | Beta Tubulin Antibody from BIORBYT LTD. |
Product Specific References | n/a |
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558