HMG4 Antibody from BIORBYT LTD.
Search, find, compare suppliers for anti-HMG4 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | HMG4 |
| Clone | 8H9 |
| Host Species | Mouse |
| Reactive Species | human, mouse, rat |
| Isotype | IgG2b |
| Format | unconjugated |
| Size | 100 ug, 10 ug |
| Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml. |
| Applications | FC, ICC, IF, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | HMG4 Antibody (monoclonal, 8H9) |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences. |
| Other Names | "chromosomal protein, Nonhistone, HMG4 |High mobility group (nonhistone chromosomal) protein 4 |High mobility group box 3 |High mobility group protein 2a |High mobility group protein 4 |High mobility group protein B3 | High mobility group protein HMG4 |HMG 4 |HMG-2a |HMG-4 |HMG2A |HMGB 3 |HMGB3 | HMGB3_HUMAN |MGC90319 |Non histone chromosomal protein |Nonhistone chromosomal protein HMG4 " |
| Gene, Accession # | UniProt: O15347 |
| Catalog # | orb623775 |
| Price | $520 |
| Order / More Info | HMG4 Antibody from BIORBYT LTD. |
| Product Specific References | n/a |
BIORBYT LTD.
BIORBYT LTD.
7 Signet Court
Swann Road
Cambridge, CB5 8LA U.K.
P: +44 (0)1223 859 353
F: +44(0)1223 280 240
info@biorbyt.com
http://www.biorbyt.com
U.S. OFFICE
Biorbyt LLC
1100 Corporate Square Drive
Helix Center, Suite 221
St Louis, MO 63132
Email: info@biorbyt.com
Phone: +1 (415) 906-5211
Fax: +1 (415) 651-8558
Profile of BIORBYT LTD.
Return to Antibodies