Edit |   |
---|---|
Antigenic Specificity | MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) |
Clone | monoclonal |
Host Species | Mouse |
Reactive Species | human |
Isotype | IgG2a, kappa |
Format | Protein A/G purified |
Size | 100µg |
Concentration | 200µg/ml |
Applications | WB, IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Boster Bio Anti-MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Monoclonal Antibody (Catalog # M01972). Tested in WB, IHC applications. This antibody reacts with Human. |
Immunogen | Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) |
Other Names | n/a |
Gene, Accession # | MAP3K1, UniProt: Q13233 |
Catalog # | M01972 |
Price | $440 |
Order / More Info | MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Antibody from BOSTER BIO |
Product Specific References | n/a |