Edit |   |
---|---|
Antigenic Specificity | NECAB1 |
Clone | CBP756 |
Host Species | Mouse |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | n/a |
Concentration | n/a |
Applications | IHC-P; WB; |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse Anti-NECAB1 Monoclonal Antibody (CBP756) |
Immunogen | Recombinant fragment corresponding to Human NECAB1 aa 135-198. Sequence: LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSS RRVQRHNSFSPNSP Database link: Q8N987 |
Other Names | N-Terminal EF-Hand Calcium Binding Protein 1; Neuronal Calcium-Binding Protein 1; EF-Hand Calcium-Binding Protein 1; EFCBP1; N-Terminal EF-Hand Calcium-Binding Protein 1; Synaptotagmin Interacting Protein 1; EF-Hand Calcium Binding Protein 1; Neuronal Calcium Binding Protein; STIP-1; |
Gene, Accession # | UniProt: UniProt: UniProt: Q9ESB5 |
Catalog # | NAB-0720-Z2830 |
Price | please inquire |
Order / More Info | NECAB1 Antibody from CREATIVE BIOLABS, INC. |
Product Specific References | n/a |