TGF beta 2/TGFB2 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-TGF beta 2/TGFB2 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | TGF beta 2/TGFB2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Rabbit IgG polyclonal antibody for TGF beta 2 detection. Tested with WB in Human; Mouse; Rat.Background: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human TGF beta 2 (ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPK). |
| Other Names | [Transforming growth factor beta-2; TGF-beta-2; BSC-1 cell growth inhibitor; Cetermin; Glioblastoma-derived T-cell suppressor factor; G-TSF; Polyergin; Latency-associated peptide; LAP; TGFB2; Transforming growth factor beta 2] |
| Gene, Accession # | [TGFB2], Gene ID: 7042, NCBI: NP_001129071.1, UniProt: P61812 |
| Catalog # | MBS1751283 |
| Price | $315 |
| Order / More Info | TGF beta 2/TGFB2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Noma T, Glick AB, Geiser AG, et al. (1992). Molecular cloning and structure of the human transforming growth factor-beta 2 gene promoter. Growth Factors. 4 (4): 247-55. 2. Webb NR, Madisen L, Rose TM, Purchio AF (1989). Structural and sequence analysis of TGF-beta 2 cDNA clones predicts two different precursor proteins produced by alternative mRNA splicing. DNA. 7 (7): 493-7. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies