IGFBP3 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-IGFBP3 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | IGFBP3 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin, ELISA (EIA) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 3(IGFBP3) detection. Tested with WB, IHC-P, ELISA in Human;Rat. Background: IGFBP3, Insulin-like growth fator-binding protein 3, is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. IGFBP3 is located on chromosome 7. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding di |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences. Ig Type: Rabbit IgG |
| Other Names | [Insulin-like growth factor-binding protein 3; Acid stable subunit of the 140 K IGF complex; Binding protein 29; Binding protein 53; BP 53; BP53; Growth hormone dependent binding protein; IBP 3; IBP-3; IBP3; IBP3_HUMAN; IGF binding protein 3; IGF-binding protein 3; IGFBP 3; IGFBP-3; IGFBP3; Insulin Like Growth Factor Binding Protein 3; Insulin-like growth factor-binding protein 3; insulin-like growth factor binding protein 3], [IGFBP3; IGFBP3; IBP3; BP-53; IBP3; IBP-3; IGF-binding protein 3; IGFBP-3] |
| Gene, Accession # | [IGFBP3], Gene ID: 3486, NCBI: NP_000589.2, UniProt: P17936 |
| Catalog # | MBS178228 |
| Price | $315 |
| Order / More Info | IGFBP3 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Lofqvist, C., Chen, J., Connor, K. M., Smith, A. C. H., Aderman, C. M., Liu, N., Pintar, J. E., Ludwig, T., Hellstrom, A., Smith, L. E. H. IGFBP3 suppresses retinopathy through suppression of oxygen-induced vessel loss and promotion of vascular regrowth.Proc. Nat. Acad. Sci. 104: 10589-10594, 2007. 2. Nwosu BU, et al. Evidence of insulin-like growth factor binding protein-3 proteolysis during growth hormone stimulation testing. J Pediatr Endocrinol Metab, 2011. 3. Relationship of insulin-like growth factor (IGF) binding protein-3 (IGFBP-3) gene polymorphism with the susceptibility to development of prostate cancer and influence on serum levels of IGF-I, and IGFBP-3. Safarinejad MR, et al. Growth Horm IGF Res, 2011 Jun. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies