PSMA2 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-PSMA2 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | PSMA2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-2(PSMA2) detection. Background: Proteasome subunit alpha type-2 is a protein that in humans is encoded by the PSMA2 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PSMA2 (82-123aa DYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYT Q), identical to the related mouse and rat sequences. |
| Other Names | [HC3; MU; PMSA2; PSC2; PSC3; PSMA 2; PSMA2; P25787; Proteasome subunit alpha type-2; proteasome subunit alpha 2], [PSMA2; PSMA2; MU; HC3; PSC2; PMSA2; HC3; PSC3] |
| Gene, Accession # | [PSMA2], Gene ID: 5683, NCBI: NP_002778.1, UniProt: P25787 |
| Catalog # | MBS178844 |
| Price | $280 |
| Order / More Info | PSMA2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Groll M, Ditzel L, Lowe J, Stock D, Bochtler M, Bartunik HD, Huber R (Apr 1997). Structure of 20S proteasome from yeast at 2.4 A resolution. Nature 386 (6624): 463-71.2. Tomko RJ, Hochstrasser M (2013). Molecular architecture and assembly of the eukaryotic proteasome. Annual Review of Biochemistry 82: 415-45. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies