Nav1.5 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Nav1.5 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Nav1.5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse. predicted to work with: human. |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Sodium channel protein type 5 subunit alpha (SCN5A) detection. Background: SCN5A is the gene that encodes the cardiac sodium channel NaV1.5. The protein encoded by this gene is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. This protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram. Defects in this gene are a cause of long QT syndrome type 3 (LQT3), an autosomal dominant cardiac disease. Alternative splicing results in several transcript variants encoding different isoforms. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Nav1.5 (1896-1932aa LRRKHEEVSAMVIQRAFRRHLLQRSLKHASFLFRQQA), different from the related mouse and rat sequences by two amino acids. |
| Other Names | [CDCD2; CMD1E; CMPD2; HB1; HB2; HBBD; HH1; ICCD; IVF; LQT3; Nav1.5; PFHB1; Scn5a; SSS1; VF1; Q14524; Sodium channel protein type 5 subunit alpha; sodium voltage-gated channel alpha subunit 5], [SCN5A; SCN5A; HB1; HB2; HH1; IVF; VF1; HBBD; ICCD; LQT3; SSS1; CDCD2; CMD1E; CMPD2; PFHB1; Nav1.5] |
| Gene, Accession # | [SCN5A], Gene ID: 6331, NCBI: NP_000326.2, UniProt: Q14524 |
| Catalog # | MBS178458 |
| Price | $280 |
| Order / More Info | Nav1.5 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Abriel H (Jan 2010). Cardiac sodium channel Na(v)1.5 and interacting proteins: Physiology and pathophysiology. Journal of Molecular and Cellular Cardiology 48 (1): 2-11.2. Schroeter A, Walzik S, Blechschmidt S, Haufe V, Benndorf K, Zimmer T (Jul 2010). Structure and function of splice variants of the cardiac voltage-gated sodium channel Na(v)1.5. Journal of Molecular and Cellular Cardiology 49 (1): 16-24.3. Wang Q, Shen J, Splawski I, Atkinson D, Li Z, Robinson JL, Moss AJ, Towbin JA, Keating MT (Mar 1995). SCN5A mutations associated with an inherited cardiac arrhythmia, long QT syndrome. Cell 80 (5): 805-11. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies