Hsp90 beta Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Hsp90 beta antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Hsp90 beta |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Heat shock protein HSP 90-beta(HSP90AB1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences. Ig Type: Rabbit IgG |
| Other Names | [Heat shock protein HSP 90-beta; 90 kda heat shock protein beta HSP90 beta; D6S182; FLJ26984; Heat shock 84 kDa; Heat shock 90kD protein 1, beta; Heat shock 90kDa protein 1 beta; Heat shock protein 90kDa alpha (cytosolic) class B member 1; Heat shock protein beta; Heat shock protein HSP 90 beta; Heat shock protein HSP 90-beta; HS90B_HUMAN; HSP 84; HSP 90; HSP 90 b; HSP 90b; HSP84; HSP90 BETA; hsp90ab1; HSP90B; HSPC2; HSPCB; heat shock protein 90kDa alpha (cytosolic), class B member 1], [HSP90AB1; HSP90AB1; HSP84; HSPC2; HSPCB; D6S182; HSP90B; HSP90B; HSPC2; HSPCB; HSP 90; HSP 84; HSP84] |
| Gene, Accession # | Gene ID: 3326, NCBI: NP_001258898.1, UniProt: P08238 |
| Catalog # | MBS177979 |
| Price | $315 |
| Order / More Info | Hsp90 beta Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: HSP90AB1 Heat shock protein 90kDa alpha (cytosolic), class B member 1. 2. Chen B, Piel WH, Gui L, Bruford E, Monteiro A (Dec 2005). The HSP90 family of genes in the human genome: insights into their divergence and evolution. Genomics 86 (6): 627-37. 3. Rebbe NF, Hickman WS, Ley TJ, Stafford DW, Hickman S (Sep 1989). Nucleotide sequence and regulation of a human 90-kDa heat shock protein gene. The Journal of Biological Chemistry 264 (25): 15006-11. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies