Edit |   |
---|---|
Antigenic Specificity | RHBDF1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal RHBDF1 antibody |
Immunogen | Immunogen: RHBDF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR |
Other Names | [RHBDF1; RHBDF1; RHBDF1; gene -90; RHBDF-1; RHBDF 1; EGFR-RS; FLJ22357; C16orf8; gene -89; Rhomboid 5 Homolog 1; Dist1; hDist1; FLJ2235] |
Gene, Accession # | [RHBDF1], NCBI: AIC57003.1 |
Catalog # | MBS5302375 |
Price | $430 |
Order / More Info | RHBDF1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |