DDAH2 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-DDAH2 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | DDAH2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat. |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for N (G),N (G)-dimethylarginine dimethylaminohydrolase 2 (DDAH2) detection. Background: DDAH2 is known as dimethylarginine dimethylaminohydrolase 2 which is mapped to 6p21.3 by radiation hybrid and FISH analysis. This gene encodes a dimethylarginine dimethylaminohydrolase. DDAH2 functions in nitric oxide generation by regulating the cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. The protein may be localized to the mitochondria. Alternative splicing resulting in multiple transcript variants. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH2 (190-224aa DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR), different from the related mouse and rat sequences by three amino acids. |
| Other Names | [DDAH; DDAH II; DDAHII; DDAH2; DDAH-2; DDAH 2; Dimethylargininase 2; Dimethylargininase-2; G6a; NG30; Protein G6a; S phase protein; S-phase protein; O95865; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; dimethylarginine dimethylaminohydrolase 2], [DDAH2; DDAH2; G6a; DDAH; NG30; DDAHII; HEL-S-277; DDAH; G6A; NG30; DDAH-2; Dimethylarginine dimethylaminohydrolase 2] |
| Gene, Accession # | [DDAH2], Gene ID: 23564, NCBI: NP_001289936.1, UniProt: O95865 |
| Catalog # | MBS178501 |
| Price | $315 |
| Order / More Info | DDAH2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Leiper, J. M,, Santa Maria, J., Chubb, A., MacAllister, R. J., Charles, I. G., Whitley, G. S., Vallance, P. Identification of two human dimethylarginine dimethylaminohydrolases with distinct tissue distributions and homology with microbial arginine deiminases.Biochem. J. 343: 209-214, 1999. 2. Smith, C. L., Birdsey, G. M., Anthony, S., Arrigoni, F. I., Leiper, J. M., Vallance, P. Dimethylarginine dimethylaminohydrolase activity modulates ADMA levels, VEGF expression, and cell phenotype. Biochem. Biophys. Res. Commun. 308: 984-989, 2003.3. Tran, C. T. L., Fox, M. F., Vallance, P., Leiper, J. M. Chromosomal localization, gene structure, and expression pattern of DDAH1: comparison with DDAH2 and implications for evolutionary origins. Genomics 68: 101-105, 2000. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies