SLC7A3/Cat3 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-SLC7A3/Cat3 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SLC7A3/Cat3 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Cationic amino acid transporter 3 is a protein that in humans is encoded by the SLC7A3 gene. This gene encodes a member of the solute carrier family 7. The encoded protein is a sodium-independent cationic amino acid transporter. Alternate splicing results in multiple transcripts that encoded the same protein. The International Radiation Hybrid Mapping Consortium mapped the SLC7A3 gene to the X chromosome.Protein Function: Mediates the uptake of the cationic amino acids arginine, lysine and ornithine in a sodium-independent manner. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC7A3 (1-30aa MPWQAFRRFGQKLVRRRTLESGMAETRLAR), different from the related mouse and rat sequences by four amino acids. Subcellular Localization: Cell membrane; Multi-pass membrane protein. Tissue Specificity: Highly expressed in thymus, uterus and testis. Detected at lower levels in brain, mammary gland, prostate, salivary gland and fetal spleen. In brain, highest expression in thalamus, hippocampus and amygda |
| Other Names | [Cationic amino acid transporter 3; CAT-3; CAT3; Cationic amino acid transporter y+; Solute carrier family 7 member 3; SLC7A3; ATRC3; CAT3] |
| Gene, Accession # | [SLC7A3/Cat3], Gene ID: 84889, NCBI: NP_001041629.1, UniProt: Q8WY07 |
| Catalog # | MBS1750938 |
| Price | $280 |
| Order / More Info | SLC7A3/Cat3 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies