Integrin alpha 3A Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Integrin alpha 3A antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Integrin alpha 3A |
| Clone | [158A3] |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Immunocytochemistry (IHC), Immunohistochemistry (IHC) (frozen), Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: 158A3 reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A. Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. F |
| Immunogen | Source Note: 158A3 is a Mouse monoclonal IgG2a antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin. |
| Other Names | [integrin alpha 3A; Integrin alpha-3; integrin alpha-3; VLA-3 alpha 3; alpha3-integrin; galactoprotein B3; VLA-3 subunit alpha; VLA-3 receptor, alpha 3 subunit; CD49 antigen-like family member C; integrin alpha 3; CD49 antigen-like family member C; Galactoprotein B3; GAPB3; VLA-3 subunit alpha], [Itga3; Itga3; CD49C; GAPB3; AA407068; GAPB3] |
| Gene, Accession # | Gene ID: 16400, NCBI: AAB20356.2, UniProt: Q62470 |
| Catalog # | MBS570064 |
| Price | $415 |
| Order / More Info | Integrin alpha 3A Antibody from MYBIOSOURCE INC. |
| Product Specific References | Delwel, G. O., de Melker, A. A., Hogervorst, F., Jaspars, L. H., Fles, D. L., Kuikman, I., Lindblom, A., Paulsson, M., Timpl, R., and Sonnenberg, A. (1994). Distinct and overlapping ligand specificities of the alpha 3A beta 1 and alpha 6A beta 1 integrins: recognition of laminin isoforms, Mol Biol Cell 5, 203-15. de Melker, A. A., Sterk, L. M., Delwel, G. O., Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies