Edit |   |
---|---|
Antigenic Specificity | Cytokeratin 222 Pseudogene |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: Cytokeratin 222 Pseudogene antibody was raised against the N terminal of KRT222P. Rabbit polyclonal Cytokeratin 222 Pseudogene antibody raised against the N terminal of KRT222P |
Immunogen | Immunogen: Cytokeratin 222 Pseudogene antibody was raised using the N terminal of KRT222P corresponding to a region with amino acids ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAA |
Other Names | [Cytokeratin 222 Pseudogene; Cytokeratin 222 Pseudogene; Cytokeratin -222; MGC45562; KRT222P; KA21; Cytokeratin 222; Keratin 222 Pseudogene] |
Gene, Accession # | n/a |
Catalog # | MBS5303406 |
Price | $430 |
Order / More Info | Cytokeratin 222 Pseudogene Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |