HSPA2 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-HSPA2 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | HSPA2 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Heat shock-related 70 kDa protein 2(HSPA2) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3. Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, with 91.7% identity in the nucleotide coding sequence and 98.2% in the corresponding amino acid sequence. HSPA2 has less amino acid homology to the other members of the human HSP70 gene family. HSPA2 is constitutively expressed in most tissues, with very high levels in testis and skeletal muscle. The HSPA2 gene is located on chromosome 14q22-q24. Immunohistochemica |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences. Ig Type: Rabbit IgG |
| Other Names | [Heat shock-related 70 kDa protein 2; 70kDa; DAQB 147D11.1 001; Hcp70.2; Heat shock 70 kDa protein 2; heat shock 70kDa protein 1A; Heat shock protein 2; heat shock protein 70; Heat shock protein 70.2; Heat shock related 70 kDa protein 2; Heat shock-related 70 kDa protein 2; Heat-shock protein, 70-KD, 2; Heat-shock protein, 70-KD, 3; HSP70 2; HSP70 3; Hsp70-2; HSP70-3; HSP70.2; HSP70A2; HSP72; HSP72_HUMAN; HSPA2; Hspt70; Hst70; MGC58299; MGC7795; MGC93458; OTTHUMP00000180664; Testis-specific heat shock protein-related; XXbac BCX40G17.3 001; heat shock 70kDa protein 2], [HSPA2; HSPA2; HSP70-2; HSP70-3; Heat shock 70 kDa protein 2] |
| Gene, Accession # | [HSPA2], Gene ID: 3306, NCBI: NP_068814.2, UniProt: P54652 |
| Catalog # | MBS177867 |
| Price | $315 |
| Order / More Info | HSPA2 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Bonnycastle, L. L. C., Yu, C.-E., Hunt, C. R., Trask, B. J., Clancy, K. P., Weber, J. L., Patterson, D., Schellenberg, G. D. Cloning, sequencing, and mapping of the human chromosome 14 heat shock protein gene (HSPA2). Genomics 23: 85-93, 1994. 2. Dix, D. J., Allen, J. W., Collins, B. W., Mori, C., Nakamura, N., Poorman-Allen, P., Goulding, E. H., Eddy, E. M. Targeted gene disruption of Hsp70-2 results in failed meiosis, germ cell apoptosis, and male infertility. Proc. Nat. Acad. Sci. 93: 3264-3268, 1996. 3. Hunt, C. R., Gasser, D. L., Chaplin, D. D., Pierce, J. C., Kozak, C. A. Chromosomal localization of five murine HSP70 gene family members: Hsp70-1, Hsp70-2, Hsp70-3, Hsc70t and Grp78. Genomics 16: 193-198, 1993. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies