Edit |   |
Antigenic Specificity | MMP9 |
Clone | polyclonal |
Host Species | n/a |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB), ELISA (EIA) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Rabbit IgG polyclonal antibody for Matrix metalloproteinase-9(MMP9) detection. Tested with WB, ELISA in Human. Background: Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MMP9 (633-667aa WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by sixteen amino acids. Ig Type: Rabbit IgG |
Other Names | [Matrix metalloproteinase-9; 82 kDa matrix metalloproteinase-9; 92 kDa gelatinase; 92 kDa type IV collagenase; CLG 4B; CLG4B; Collagenase Type 4 beta; Collagenase type IV 92 KD; EC 3.4.24.35; Gelatinase 92 KD; Gelatinase B; Gelatinase beta; GelatinaseB; GELB; Macrophage gelatinase; MANDP2; Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); Matrix Metalloproteinase 9; MMP 9; MMP-9; MMP9; MMP9_HUMAN; Type V collagenase; matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)], [MMP9; MMP9; GELB; CLG4B; MMP-9; MANDP2; CLG4B; MMP-9; GELB] |
Gene, Accession # | [MMP9], Gene ID: 4318, NCBI: NP_004985.2, UniProt: P14780 |
Catalog # | MBS178213 |
Price | $280 |
Order / More Info | MMP9 Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Template:, 92kDa type IV collagenase). 2. Yuichiro Hirose et al. (May 2008). A Functional Polymorphism in THBS2 that Affects Alternative Splicing and MMP Binding Is Associated with Lumbar-Disc Herniation. |