Edit |   |
---|---|
Antigenic Specificity | BAG4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 3.63 mg/ml |
Applications | Western Blot (WB), Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. This protein was found to be associated with the death domain of tumor necrosis factor receptor type 1 (TNF-R1) and death receptor-3 (DR3), and thereby negatively regulates downstream cell death signaling. The regulatory role of this protein in cell death was demonstrated |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BAG4 (NP 001191807.1). Immunogen Sequence: MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGDGYYPSGGAWPEPGRAGGSHQSLNSYTNGAY |
Other Names | [BAG4; BAG-4; SODD; BCL2 associated athanogene 4] |
Gene, Accession # | [BAG4], Gene ID: 9530, NCBI: NP_001191807.1, UniProt: O95429 |
Catalog # | MBS9141030 |
Price | $260 |
Order / More Info | BAG4 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |