Edit |   |
---|---|
Antigenic Specificity | RBP7 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 2.16 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs; however, it has a lower binding affinity for retinol than other CRBPs. |
Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human RBP7 (NP 443192.1). Immunogen Sequence: MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA |
Other Names | [RBP7; CRABP4; CRBP4; CRBPIV; retinol binding protein 7] |
Gene, Accession # | [RBP7], Gene ID: 116362, NCBI: NP_443192.1, UniProt: Q96R05 |
Catalog # | MBS9140631 |
Price | $260 |
Order / More Info | RBP7 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |