ITLN1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-ITLN1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | ITLN1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human. |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Intelectin-1 (ITLN1) detection. Background: Intelectin-1, also known as omentin, is an intelectin encoded in humans by the ITLN1 gene. This gene is mapped to chromosome 1q21.3-q22 by genomic sequence analysis. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin. Having conserved ligand binding site residues, both human and mouse intelectin-1 bind the exocyclic vicinal diol of carbohydrate ligands such as galactofuranose. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ITLN1 (19-59aa TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR). |
| Other Names | [Endothelial lectin HL 1; Endothelial lectin HL-1; hIntL; HL1; HL 1; Intelectin; Intelectin-1; Intelectin 1; INTL; ITLN; ITLN-1; ITLN1; LFR; Omentin; Q8WWA0; Intelectin-1; intelectin 1], [ITLN1; ITLN1; HL1; LFR; HL-1; INTL; ITLN; hIntL; omentin; INTL; ITLN; LFR; ITLN-1] |
| Gene, Accession # | [ITLN1], Gene ID: 55600, NCBI: NP_060095.2, UniProt: Q8WWA0 |
| Catalog # | MBS178504 |
| Price | $315 |
| Order / More Info | ITLN1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: ITLN1 intelectin 1 (galactofuranose binding).2. Lee JK, Schnee J, Pang M, Wolfert M, Baum LG, Moremen KW, Pierce M (Feb 2001). Human homologs of the Xenopus oocyte cortical granule lectin XL35. Glycobiology 11 (1): 65-73.3. Tsuji S, Uehori J, Matsumoto M, Suzuki Y, Matsuhisa A, Toyoshima K, Seya T (Jun 2001). Human intelectin is a novel soluble lectin that recognizes galactofuranose in carbohydrate chains of bacterial cell wall. J Biol Chem 276 (26): 23456-63. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies