KAT13D/CLOCK Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-KAT13D/CLOCK antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | KAT13D/CLOCK |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Circadian locomoter output cycles protein kaput(CLOCK) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Clock (Circadian Locomotor Output Cycles Kaput) is also known as KAT13D. The protein encoded by this gene plays a central role in the regulation of circadian rhythms. This protein encodes a transcription factor of the basic helix-loop-helix (bHLH) family and contains DNA binding histone acetyltransferase activity. And the encoded protein forms a heterodimer with ARNTL (BMAL1) that binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress th |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human KAT13D/CLOCK (75-109aa QKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence. Ig Type: Rabbit IgG |
| Other Names | [Circadian locomoter output cycles protein kaput; bHLHe8; Circadian locomoter output cycles kaput protein; Circadian locomoter output cycles protein kaput; Circadian Locomotor Output Cycles Kaput; Circadium Locomotor Output Cycles Kaput; Class E basic helix-loop-helix protein 8; CLOCK; Clock circadian regulator; Clock homolog; Clock protein; CLOCK_HUMAN; hCLOCK; KIAA0334; clock circadian regulator], [CLOCK; CLOCK; KAT13D; bHLHe8; BHLHE8; KIAA0334; hCLOCK; bHLHe8] |
| Gene, Accession # | [KAT13D/CLOCK], Gene ID: 9575, NCBI: NP_001254772.1, UniProt: O15516 |
| Catalog # | MBS178359 |
| Price | $315 |
| Order / More Info | KAT13D/CLOCK Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Dunlap JC (Jan 1999). Molecular bases for circadian clocks. Cell 96 (2): 271-90. 2. King DP, Zhao Y, Sangoram AM, Wilsbacher LD, Tanaka M, Antoch MP, Steeves TD, Vitaterna MH, Kornhauser JM, Lowrey PL, Turek FW, Takahashi JS (May 1997). Positional cloning of the mouse circadian clock gene. Cell 89 (4): 641-653. 3. Vitaterna MH, King DP, Chang AM, Kornhauser JM, Lowrey PL, McDonald JD, Dove WF, Pinto LH, Turek FW, Takahashi JS (Apr 1994). Mutagenesis and mapping of a mouse gene, Clock, essential for circadian behavior. Science 264 (5159): 719-25. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies