ACTN3 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-ACTN3 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | ACTN3 |
| Clone | monoclonal |
| Host Species | Mouse |
| Reactive Species | mouse, rat |
| Isotype | IgG1 |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Specificity: No cross reactivity with other proteins. Description: Mouse IgG monoclonal antibody for ACTN3 detection. Tested with WB, IHC-P in Mouse; Rat.Background: Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non- |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids. |
| Other Names | [Alpha-actinin-3; Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; ACTN3; Actinin alpha 3 (gene/pseudogene)] |
| Gene, Accession # | [ACTN3], Gene ID: 89, NCBI: NP_001095.2, UniProt: Q08043 |
| Catalog # | MBS1752228 |
| Price | $315 |
| Order / More Info | ACTN3 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Papadimitriou ID, Papadopoulos C, Kouvatsi A, Triantaphyllidis C (April 2008). The ACTN3 gene in elite Greek track and field athletes. Int J Sports Med 29 (4): 352-5. 2. Yang N, MacArthur DG, Gulbin JP, Hahn AG, Beggs AH, Easteal S, North K (September 2003). ACTN3 genotype is associated with human elite athletic performance. Am. J. Hum. Genet. 73 (3): 627-31. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies