LIMK1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-LIMK1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | LIMK1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for LIM domain kinase 1(LIMK1) detection. Tested with WB in Human;Mouse;Rat. Background: LIM domain kinase 1 is an enzyme that in humans is encoded by the LIMK1 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs, a central PDZ domain, and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellula |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LIMK1 (599-634aa KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids. Ig Type: Rabbit IgG |
| Other Names | [LIM domain kinase 1; EC 2.7.11.1; LIM domain kinase 1; LIM motif-containing protein kinase; LIMK; LIMK-1; limk1; LIMK1_HUMAN; LIM domain kinase 1], [LIMK1; LIMK1; LIMK; LIMK-1; LIMK; LIMK-1] |
| Gene, Accession # | [LIMK1], Gene ID: 3984, NCBI: NP_001191355.1, UniProt: P53667 |
| Catalog # | MBS177701 |
| Price | $280 |
| Order / More Info | LIMK1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: LIMK1 LIM domain kinase 1. 2. Osborne LR, Martindale D, Scherer SW, Shi XM, Huizenga J, Heng HH, Costa T, Pober B, Lew L, Brinkman J, Rommens J, Koop B, Tsui LC (Jan 1997). Identification of genes from a 500-kb region at 7q11.23 that is commonly deleted in Williams syndrome patients. Genomics 36 (2): 328-36. 3. Tassabehji M, Metcalfe K, Fergusson WD, Carette MJ, Dore JK, Donnai D, Read AP, Proschel C, Gutowski NJ, Mao X, Sheer D (Aug 1996). LIM-kinase deleted in Williams syndrome. Nat. Genet. 13 (3): 272-3. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies