PIAS3 Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-PIAS3 Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | PIAS3 Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | unconjugated |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: E3 SUMO-protein ligase PIAS3 is an enzyme that in humans is encoded by the PIAS3 gene. This gene encodes a member of the PIAS [protein inhibitor of activated STAT (signal transducer and activator of transcription)] family of transcriptional modulators. The protein functions as a SUMO (small ubiquitin-like modifier)-E3 ligase which catalyzes the covalent attachment of a SUMO protein to specific target substrates. It directly binds to several transcription factors and either blocks or enhances their activity. Alternatively spliced transcript variants of this gene have been identified, but the full-length nature of some of these variants has not been determined.Protein Function: Functions as an E3-type small ubiquitin-like mod |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence of human PIAS3 (QRFEEAHFTFALTPQQVQQILTSREVLPGAKCDYTIQVQLRF). Subcellular Localization: Cytoplasm. Tissue Specificity: Widely expressed. |
| Other Names | [E3 SUMO-protein ligase PIAS3; Protein inhibitor of activated STAT protein 3; PIAS3] |
| Gene, Accession # | [PIAS3], Gene ID: 10401, NCBI: NP_006090.2, UniProt: Q9Y6X2 |
| Catalog # | MBS1750791 |
| Price | $280 |
| Order / More Info | PIAS3 Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies