Stathmin 1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Stathmin 1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Stathmin 1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Stathmin(STMN1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Stathmin 1/oncoprotein 18, also known as STMN1, is a highly conserved 17 kDa protein. This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Stathmin 1 (2-34aa ASSDIQVKELEKRASGQAFELILSPRSKESVPE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence. Ig Type: Rabbit IgG |
| Other Names | [Stathmin; C1orf215; Lag; LAP 18; LAP18; Leukemia associated phosphoprotein p18; Leukemia-associated phosphoprotein p18; Metablastin; Oncoprotein 18; OP 18; OP18; p18; p19; Phosphoprotein 19; Phosphoprotein p19; PP17; PP19; PR22; Pr22 protein; Prosolin; Protein Pr22; SMN; Stathmin; Stathmin1; STMN 1; STMN1; STMN1_HUMAN; stathmin 1], [STMN1; STMN1; Lag; SMN; OP18; PP17; PP19; PR22; LAP18; C1orf215; C1orf215; LAP18; OP18; Op18; pp19] |
| Gene, Accession # | Gene ID: 3925, NCBI: NP_001138926.1, UniProt: P16949 |
| Catalog # | MBS178178 |
| Price | $315 |
| Order / More Info | Stathmin 1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Cassimeris L (February 2002). The oncoprotein 18/stathmin family of microtubule destabilizers. Curr. Opin. Cell Biol. 14 (1): 18-24. 2. Clement MJ, Jourdain I, Lachkar S, Savarin P, Gigant B, Knossow M, Toma F, Sobel A, Curmi PA (November 2005). N-terminal stathmin-like peptides bind tubulin and impede microtubule assembly. Biochemistry 44 (44): 14616-25. 3. Jourdain L, Curmi P, Sobel A, Pantaloni D, Carlier MF (September 1997). Stathmin: a tubulin-sequestering protein which forms a ternary T2S complex with two tubulin molecules. Biochemistry 36 (36): 10817-21. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies