Nectin-4/PVRL4 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Nectin-4/PVRL4 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Nectin-4/PVRL4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Nectin-4(NECTIN4) detection. Background: PVRL4, also known as Nectin-4, is expressed in human skin, hair follicles, and cultured keratinocytes, but not in fibroblasts. This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dyspla |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Nectin-4/PVRL4 (53-94aa FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY), different from the related mouse sequence by seven amino acids. |
| Other Names | [EDSS1; Nectin 4; Nectin-4; PRR4; pvrl4; Q96NY8; nectin cell adhesion molecule 4], [NECTIN4; NECTIN4; LNIR; PRR4; EDSS1; PVRL4; nectin-4] |
| Gene, Accession # | [NECTIN4], Gene ID: 81607, NCBI: NP_112178.2, UniProt: Q96NY8 |
| Catalog # | MBS178847 |
| Price | $280 |
| Order / More Info | Nectin-4/PVRL4 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Brancati, F., Fortugno, P., Bottillo, I., Lopez, M., Josselin, E., Boudghene-Stambouli, O., Agolini, E., Bernardini, L., Bellacchio, E., Iannicelli, M., Rossi, A., Dib-Lachachi, A., Stuppia, L., Palka, G., Mundlos, S., Stricker, S., Kornak, U., Zambruno, G., Dallapiccola, B.Mutations in PVRL4, encoding cell adhesion molecule nectin-4, cause ectodermal dysplasia-syndactyly syndrome.Am. J. Hum. Genet. 87: 265-273, 2010.2. Fabre-Lafay, S., Garrido-Urbani, S., Reymond, N., Goncalves, A., Dubreuil, P., Lopez, M. Nectin-4, a new serological breast cancer marker, is a substrate for tumor necrosis factor-alpha-converting enzyme (TACE)/ADAM-17. J. Biol. Chem. 280: 19543-19550, 2005.3. Muhlebach, M. D., Mateo, M., Sinn, P. L., Prufer, S., Uhlig, K. M., Leonard, V. H. J., Navaratnarajah, C. K., Frenzke, M., Wong, X. X., Sawatsky, B., Ramachandran, S., McCray, P. B., Jr., Cichutek, K., von Messling, V., Lopez, M., Cattaneo, R. Adherens junction protein nectin-4 is the epithelial receptor for measles virus. Nature 480: 530-533, 2011. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies