Cytokeratin 1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Cytokeratin 1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Cytokeratin 1 |
| Clone | polyclonal |
| Host Species | n/a |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: Rabbit IgG polyclonal antibody for Keratin, type II cytoskeletal 1(KRT1) detection. Tested with WB, IHC-P in Human;Mouse;Rat. Background: Keratin 1 (KRT1), also known as Cytokeratin 1, or Keratin, type II cytoskeletal 1, is a member of the keratin family. It is specifically expressed in the spinous and granular layers of the epidermis with family member keratin 10. Mutations in this gene have been associated with the variants ofbullous congenital ichthyosiform erythroderma in which the palms and soles of the feet are affected. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. And |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse Cytokeratin 1 (223-257aa LQQVDTTTRTQNLDPFFENYISILRRKVDSLKSD Q), different from the related human sequence by ten amino acids, and from the related rat sequence by five amino acids. Ig Type: Rabbit IgG |
| Other Names | [Keratin; 67 kDa cytokeratin; CK-1; CK1; Cytokeratin-1; Cytokeratin1; EHK; EHK1; Epidermolytic hyperkeratosis 1; EPPK; Hair alpha protein; K1; K2C1_HUMAN; Keratin; Keratin type II cytoskeletal 1; Keratin-1; Keratin1; KRT 1; Krt1; KRT1A; NEPPK; type II cytoskeletal 1; Type II keratin Kb1; Type-II keratin Kb1; keratin 1, type II], [Krt1; Krt1; Krt86; Krt2-1; Krt-2.1; Krt2-1; CK-1; K1] |
| Gene, Accession # | Gene ID: 16678, NCBI: NP_032499.2, UniProt: P04104 |
| Catalog # | MBS178145 |
| Price | $315 |
| Order / More Info | Cytokeratin 1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Entrez Gene: KRT1 keratin 1 (epidermolytic hyperkeratosis). 2. Whittock NV, Ashton GH, Griffiths WA et al. (2001). New mutations in keratin 1 that cause bullous congenital ichthyosiform erythroderma and keratin 2e that cause ichthyosis bullosa of Siemens. Br. J. Dermatol. 145(2): 330-5. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies