PSMA3 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-PSMA3 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | PSMA3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-3(PSMA3) detection. Background: Proteasome subunit alpha type-3, also known as macropain subunit C8 and proteasome component C8, is a protein that in humans is encoded by the PSMA3 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteaso |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PSMA3 (88-127aa LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS), identical to the related mouse and rat sequences. |
| Other Names | [HC8; Macropain subunit C8; PSC8; psmA3; P25788; Proteasome subunit alpha type-3; proteasome subunit alpha 3], [PSMA3; PSMA3; HC8; PSC3; HC8; PSC8] |
| Gene, Accession # | [PSMA3], Gene ID: 5684, NCBI: NP_002779.1, UniProt: P25788 |
| Catalog # | MBS178845 |
| Price | $315 |
| Order / More Info | PSMA3 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Coux O, Tanaka K, Goldberg AL (Nov 1996). Structure and functions of the 20S and 26S proteasomes.Annu Rev Biochem 65: 801-47.2. Tamura T, Lee DH, Osaka F, Fujiwara T, Shin S, Chung CH, Tanaka K, Ichihara A (Jun 1991). Molecular cloning and sequence analysis of cDNAs for five major subunits of human proteasomes (multi-catalytic proteinase complexes). Biochim Biophys Acta 1089 (1): 95-102. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies