Annexin IV Picoband Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-Annexin IV Picoband antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Annexin IV Picoband |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: ANXA4 (Annexin A4), also known as ANX4, is a protein that in humans is encoded by the ANXA4 gene. It belongs to the annexin family of calcium-dependent phospholipid binding proteins. By PCR analysis of somatic cell hybrids and in situ hybridization with a cDNA probe, the human ANXA4 gene is mapped to chromosome 2p13. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. And ANXA4 is almost exclusively expressed in epithelial cells.Protein Function: Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Annexin IV (119-152aa EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL), different from the related mouse and rat sequences by three amino acids. |
| Other Names | [Annexin A4; 35-beta calcimedin; Annexin IV; Annexin-4; Carbohydrate-binding protein p33/p41; Chromobindin-4; Endonexin I; Lipocortin IV; P32.5; PP4-X; Placental anticoagulant protein II; PAP-II; Protein II; ANXA4; ANX4] |
| Gene, Accession # | [ANXA4], Gene ID: 307, NCBI: NP_001144.1, UniProt: P09525 |
| Catalog # | MBS1750885 |
| Price | $315 |
| Order / More Info | Annexin IV Picoband Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies