Edit |   |
---|---|
Antigenic Specificity | TIMM44 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit polyclonal TIMM44 antibody |
Immunogen | Immunogen: TIMM44 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKS |
Other Names | [TIMM44; TIMM44; Translocase Of Inner Mitochondrial Membrane 44 Homolog; TIMM-44; TIMM 44; DKFZp686H05241; TIMM44; TIM44] |
Gene, Accession # | [TIMM44], Gene ID: 10469, NCBI: AKI71212.1 |
Catalog # | MBS5303345 |
Price | $430 |
Order / More Info | TIMM44 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |