Edit |   |
Antigenic Specificity | SMURF 2 |
Clone | polyclonal |
Host Species | n/a |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 mg |
Concentration | n/a |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Description: Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase SMURF2(SMURF2) detection. Tested with WB in Human. Background: E3 ubiquitin-protein ligase SMURF2 is an enzyme that in humans is encoded by the SMURF2 gene. The SMURF2 gene is mapped to chromosome 17q22-q23 based on sequence similarity between the SMURF2 sequence and a genomic contig. SMURF2 is a HECT domain E3 ubiquitin ligase involved in degradation of SMADs, TGF-beta receptor (TGFBR), and other substrates. It also functions in regulation of neuronal and planar cell polarity, induction of senescence, and tumor suppression |
Immunogen | Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human SMURF 2 (317-351aa DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQ), identical to the related mouse sequence. Ig Type: Rabbit IgG |
Other Names | [E3 ubiquitin-protein ligase SMURF2; E3 ubiquitin-protein ligase SMURF2; EC 6.3.2.; hSMURF2; MGC138150; Smad specific E3 ubiquitin ligase 2; SMAD specific E3 ubiquitin protein ligase 2; SMAD ubiquitination regulatory factor 2; SMAD-specific E3 ubiquitin-protein ligase 2; SMUF2_HUMAN; Smurf2; Ubiquitin protein ligase SMURF2; SMAD specific E3 ubiquitin protein ligase 2], [SMURF2; SMURF2; hSMURF2] |
Gene, Accession # | [SMURF 2], Gene ID: 64750, NCBI: NP_073576.1, UniProt: Q9HAU4 |
Catalog # | MBS178265 |
Price | $280 |
Order / More Info | SMURF 2 Antibody from MYBIOSOURCE INC. |
Product Specific References | 1. Entrez Gene: SMURF2 SMAD specific E3 ubiquitin protein ligase 2. 2. Blank, M., Tang, Y., Yamashita, M., Burkett, S. S., Cheng, S. Y., Zhang, Y. E. A tumor suppressor function of Smurf2 associated with controlling chromatin landscape and genome stability through RNF20. Nature Med. 18: 227-234, 2012. 3. Lin X, Liang M, Feng XH (Nov 2000). Smurf2 is a ubiquitin E3 ligase mediating proteasome-dependent degradation of Smad2 in transforming growth factor-beta signaling. The Journal of Biological Chemistry 275(47): 36818-22. |