CPM Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-CPM antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | CPM |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Carboxypeptidase M(CPM) detection. Background: CPM, mapped to 12q15, is known as Carboxypeptidase M. The protein encoded by this gene is a membrane-bound arginine/lysine carboxypeptidase. Its expression is associated with monocyte to macrophage differentiation. This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 potential asparagine-linked glycosylation sites. The active site residues of carboxypeptidases A and B are conserved in this protein. Three alternatively spliced transcript variants encoding the same protein have been described for this gene. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CPM (286-316aa KYPREEKLPSFWNNNKASLIEYIKQVHLGVK), different from the related mouse sequence by two amino acids. |
| Other Names | [Carboxypeptidase M; CPM; Renal carboxypeptidase; Urinary carboxypeptidase B; P14384], [CPM; CPM; CPM] |
| Gene, Accession # | [CPM], Gene ID: 1368, NCBI: NP_001005502.1, UniProt: P14384 |
| Catalog # | MBS178652 |
| Price | $280 |
| Order / More Info | CPM Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Kas, K., Schoenmakers, E. F. P. M., Van de Ven, W. J. M. Physical map location of the human carboxypeptidase M gene (CPM) distal to D12S375 and proximal to D12S8 at chromosome 12q15. Genomics 30: 403-405, 1995.2. Rehli, M., Krause, S. W., Kreutz, M., Andreesen, R. Carboxypeptidase M is identical to the MAX.1 antigen and its expression is associated with monocyte to macrophage differentiation. J. Biol. Chem. 270: 15644-15649, 1995.3. Tan, F., Chan, S. J., Steiner, D. F., Schilling, J. W., Skidgel, R. A. Molecular cloning and sequencing of the cDNA for human membrane-bound carboxypeptidase M: comparison with carboxypeptidases A, B, H, and N. J. Biol. Chem. 264: 13165-13170, 1989. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies