PIAS4 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-PIAS4 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | PIAS4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for E3 SUMO-protein ligase PIAS4(PIAS4) detection. Background: E3 SUMO-protein ligase PIAS4, also known as protein inhibitor of activated STAT protein 4 (PIAS4) or protein inhibitor of activated STAT protein gamma (PIASg or PIASy), is an enzyme that in humans is encoded by the PIAS4 gene. This gene is mapped to 19p13.3. This gene plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. It also functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. This gene involved in g |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PIAS4 (130-174aa EVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVE), different from the related mouse sequence by two amino acids. |
| Other Names | [E3 SUMOprotein ligase PIAS4; E3 SUMO-protein ligase PIAS4; PIASG; PIASgamma; PIAS-gamma; PIASy; Q8N2W9; protein inhibitor of activated STAT, 4], [PIAS4; PIAS4; PIASY; Piasg; ZMIZ6; PIAS-gamma; PIASG; PIAS-gamma] |
| Gene, Accession # | [PIAS4], Gene ID: 51588, NCBI: NP_056981.2, UniProt: Q8N2W9 |
| Catalog # | MBS178838 |
| Price | $280 |
| Order / More Info | PIAS4 Antibody from MYBIOSOURCE INC. |
| Product Specific References | 1. Bischof, O., Schwamborn, K., Martin, N., Werner, A., Sustmann, C., Grosschedl, R., Dejean, A. The E3 SUMO ligase PIASy is a regulator of cellular senescence and apoptosis. Molec. Cell 22: 783-794, 2006.2. Galanty, Y., Belotserkovskaya, R., Coates, J., Polo, S., Miller, K. M., Jackson, S. P. Mammalian SUMO E3-ligases PIAS1 and PIAS4 promote responses to DNA double-strand breaks. Nature 462: 935-939, 2009.3. Sachdev, S., Bruhn, L., Sieber, H., Pichler, A., Melchior, F., Grosschedl, R. PIASy, a nuclear matrix-associated SUMO E3 ligase, represses LEF1 activity by sequestration into nuclear bodies. Genes Dev. 15: 3088-3103, 2001. |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies