SLC6A1/Gat 1 Antibody from MYBIOSOURCE INC.
Search, find, compare suppliers for anti-SLC6A1/Gat 1 antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | SLC6A1/Gat 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 mg |
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Description: GABA transporter 1 (GAT1), also known as sodium- and chloride-dependent GABA transporter 1, is a protein that in humans is encoded by the SLC6A1 gene. GABA Transporter 1 uses Na+ and Cl- to create a gradient, which removes or adds GABA to extracellular spaces in the cerebrum and cerebellum. The stoichiometry for GABA Transporter 1 is 2 Na+: 1 Cl-: 1 GABA. The activity of GAT1 is largely dependent on the presence of Na+, while Cl- assists by increasing the ability for GAT-1 to uptake GABA.Protein Function: Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals. |
| Immunogen | Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC6A1 (23-54aa ANDKPKTLVVKVQKKAADLPDRDTWKGRFDFL), different from the related mouse and rat sequences by two amino acids. Subcellular Localization: Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Localized at the plasma membrane and in a subset of intracellular vesicles. Localized at the presynaptic terminals of interneurons (By similarity). |
| Other Names | [Sodium- and chloride-dependent GABA transporter 1; GAT-1; Solute carrier family 6 member 1; SLC6A1; GABATR; GABT1; GAT1] |
| Gene, Accession # | [SLC6A1/Gat 1], Gene ID: 6529, NCBI: NP_001335179.1, UniProt: P30531 |
| Catalog # | MBS1750893 |
| Price | $280 |
| Order / More Info | SLC6A1/Gat 1 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |
MYBIOSOURCE INC.
MYBIOSOURCE INC.
P.O. Box 153308
San Diego CA 92195-3308
P: 1.858.633.0165
P: 1.888.MBS.0165 (1.888.627.0165) (US & Canada)
F: 1.858.633.0166
sales@mybiosource.com
http://www.MyBioSource.com
Profile of MYBIOSOURCE INC.
Return to Antibodies