Edit |   |
---|---|
Antigenic Specificity | IL22R alpha 1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | affinity purified |
Size | 0.05 mg |
Concentration | 1 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Specificity: IL22R alpha 1 antibody was raised against the middle region of IL22RA1. Rabbit polyclonal IL22R alpha 1 antibody raised against the middle region of IL22RA1 |
Immunogen | Immunogen: IL22R alpha 1 antibody was raised using the middle region of IL22RA1 corresponding to a region with amino acids YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ |
Other Names | [IL22R alpha 1; IL22R alpha 1; ILRa 22; ILRa-22; CRF2-9; IL22Ra; Interleukin 22 Receptor Alpha 1; IL22RA1; IL22R] |
Gene, Accession # | [IL22R alpha 1], Gene ID: 58985, NCBI: NP_067081.2 |
Catalog # | MBS5302067 |
Price | $430 |
Order / More Info | IL22R alpha 1 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |