Edit |   |
---|---|
Antigenic Specificity | S100A16 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 0.1 mL |
Concentration | 3.15 mg/ml |
Applications | Western Blot (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | n/a |
Immunogen | Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human S100A16 (NP 525127.1). Immunogen Sequence: MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS |
Other Names | [S100A16; AAG13; DT1P1A7; S100F; protein S100-A16] |
Gene, Accession # | [S100A16], Gene ID: 140576, NCBI: NP_525127.1, UniProt: Q96FQ6 |
Catalog # | MBS9140761 |
Price | $260 |
Order / More Info | S100A16 Antibody from MYBIOSOURCE INC. |
Product Specific References | n/a |