Edit |   |
---|---|
Antigenic Specificity | Ataxin 1 |
Clone | S76-8 |
Host Species | Mouse |
Reactive Species | human, mouse, rat |
Isotype | IgG2b |
Format | Protein G purified |
Size | 100 µg |
Concentration | 1 mg/ml |
Applications | WB, IHC, ICC/IF, IP |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse anti-Mouse Ataxin 1 Monoclonal IgG2b. Detects ~85kDa. |
Immunogen | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). |
Other Names | Ataxin-1, ATX1, Atxn1, D6S504E, OTTHUMP00000016065, SCA1, Spinocerebellar ataxia type 1 protein |
Gene, Accession # | Gene ID: 20238, Accession: NP_001186233.1, SwissProt: P54254 |
Catalog # | SMC-455D |
Price | please inquire |
Order / More Info | Ataxin 1 Antibody from STRESSMARQ BIOSCIENCES INC. |
Product Specific References | n/a |