Edit |   |
---|---|
Product Name | E2F1 protein |
Description | Synthetic peptide corresponding to amino acids 58-93 of Human E2F1. Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD |
Size | n/a |
Concentration | n/a |
Applications | Immunodepletion, Immunocompetition. RUO |
Other Names | n/a |
Gene, Accession, CAS # | UniProt: Q01094 |
Catalog # | STJ503984 |
Price | please inquire |
Order / More Info | E2F1 protein from ST JOHN'S LABORATORY |
Product Specific References | n/a |