Enolase, Neuron Specific (NSE) Antibody from ABBEXA LTD
Search, find, compare suppliers for anti-Enolase, Neuron Specific (NSE) antibody, protein, ELISA kits.
| Edit | |
|---|---|
| Antigenic Specificity | Enolase, Neuron Specific (NSE) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 µl, 200 µl, 1 ml, |
| Concentration | n/a |
| Applications | WB, IHC, IF/ICC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | polyclonal antibody to ENO2. |
| Immunogen | NSE (Ser2-Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT) |
| Other Names | 2-phospho-D-glycerate hydro-lyase Enolase 2, Neural enolase, Neuron-specific enolase, NSE, 2-phospho-D-glycerate hydro-lyase, Enolase 2, ENO2, Neurone Specific Enolase, ENO1, ENO1L1, MPB1, PPH, Alpha Enolase, Enolase 1, Phosphopyruvate hydratase, Plasminogen-binding protein, C-myc promoter-binding, 2-phospho-D-glycerate hydro-lyase Enolase 2, 2-phospho-D-glycerate hydro-lyase Enolase 2, 2-phospho-D-glycerate hydro-lyase Enolase 2 , 2-phospho-D-glycerate hydro-lyase Enolase 2 , Neural enolase, Neural enolase, Neural enolase , Neural enolase , Neuron-specific enolase, Neuron-specific enolase, Neuron-specific enolase , Neuron-specific enolase , NSE, NSE, NSE , NSE , 2-phospho-D-glycerate hydro-lyase, 2-phospho-D-glycerate hydro-lyase, 2-phospho-D-glycerate hydro-lyase , 2-phospho-D-glycerate hydro-lyase , Enolase 2, Enolase 2, Enolase 2 , Enolase 2 , ENO2, ENO2, ENO2 , ENO2 , Neurone Specific Enolase, Neurone Specific Enolase, Neurone Specific Enolase , Neurone Specific Enolase , |
| Gene, Accession # | UniProt: P09104 |
| Catalog # | abx102348 |
| Price | please inquire |
| Order / More Info | Enolase, Neuron Specific (NSE) Antibody from ABBEXA LTD |
| Product Specific References | n/a |
ABBEXA LTD
ABBEXA LTD
181 Cambridge Science Park
Cambridge, CB4 0GJ UK
P: +44 (0) 1223 755950
Customer Service: info@abbexa.com
Technical Support: support@abbexa.com
Orders: orders@abbexa.com
https://www.abbexa.com
U.S. Office
118 Eldridge Rd, Suite C,
Sugar Land, TX 77478 USA
Telephone: +1 832 327 7413
Netherlands Office
Abbexa BV
Wattstraat 54 2723 RD,
Zoetermeer,Netherlands
Telephone: +44 (0) 1223 755950
Profile of ABBEXA LTD
Return to Antibodies