Edit |   |
---|---|
Antigenic Specificity | MKRN1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-MKRN1 polyclonal antibody, unconjugated |
Immunogen | MKRN1 antibody was raised using the N terminal of MKRN1 corresponding to a region with amino acids GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE |
Other Names | RNF61|E3 ubiquitin-protein ligase makorin-1|RING finger protein 61|makorin ring finger protein 1|MKRN1|makorin 1|makorin|ring finger protein|1|E3 ubiquitin-protein ligase makorin-1-like|LOC100393879|MGC84269|Makorin-1|MGC84269 protein|makorin ring finger protein 1 S homeolog|mkrn1.S|RFP|makorin, ring finger protein, 1|fl25h08|wu:fl25h08|zgc:110403|RING-type E3 ubiquitin transferase makorin-1|probable E3 ubiquitin-protein ligase makorin-1 |
Gene, Accession # | Gene ID: 23608, 54484, 296988, 475528 |
Catalog # | ABIN629785 |
Price | $902 |
Order / More Info | MKRN1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |