Edit |   |
---|---|
Antigenic Specificity | HNRNPR |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-HNRNPR polyclonal antibody, unconjugated |
Immunogen | HNRNPR antibody was raised using the N terminal of HNRNPR corresponding to a region with amino acids ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQ |
Other Names | hnrpr|wu:fb97a09|wu:fe01h03|zgc:56523|heterogeneous nuclear ribonucleoprotein R|hnrnpr|2610003J05Rik|2610528B01Rik|hnRNP R|hnRNP-R|hnrnpr.L|heterogeneous nuclear ribonucleoprotein R L homeolog|heterogeneous nuclear ribonucleoprotein R S homeolog|hnrnpr.S |
Gene, Accession # | Gene ID: 10236, 74326, 319110 |
Catalog # | ABIN633229 |
Price | $1020 |
Order / More Info | HNRNPR Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |