Edit |   |
---|---|
Antigenic Specificity | ENO2/NSE |
Clone | C3 |
Host Species | Mouse |
Reactive Species | human |
Isotype | IgG2b kappa |
Format | unconjugated |
Size | 1 mL |
Concentration | n/a |
Applications | Immunocytochemistry, Immunohistochemistry, Immunoprecipitation, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse anti-ENO2/NSE monoclonal antibody, unconjugated |
Immunogen | Recombinant Enolase, Neuron Specific (NSE) corresdonding to Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT with N-terminal His Tag |
Other Names | DKFZp459B1817|ENO2|enolase 2 (gamma|neuronal)|enolase 2|Enolase 2 (Gamma, Neuronal)|ENO2/NSE|2-phospho-D-glycerate hydro-lyase|NSE|gamma-enolase|gamma-subunit of enolase|neural enolase|2-phospho-D-glycerate hydrolyase|neuron specific gamma enolase|neuron-specific enolase|neurone-specific enolase|enolase 2-like|gamma-enolase-like|AI837106|D6Ertd375e|Eno-2|enolase 2, gamma neuronal|RNEN3|enolase 2, gamma, neuronal|eno3|wu:fc09h05|zgc:92418|fc09h05|2-phospho-D-glycerate hydro-lyase 2|2-phosphoglycerate dehydratase 2|PCO068679|PCO068679_ov|Pgh-|enolase|pENO2 |
Gene, Accession # | Gene ID: 2026 |
Catalog # | ABIN7427919 |
Price | $426 |
Order / More Info | ENO2/NSE Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |