Edit |   |
---|---|
Antigenic Specificity | PLA2G5 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PLA2G5 polyclonal antibody, unconjugated |
Immunogen | PLA2 G5 antibody was raised using the N terminal of PLA2 5 corresponding to a region with amino acids MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW |
Other Names | FRFB|GV-PLA2|PLA2-10|hVPLA(2)|Ca2+-dependent phospholipase A2|calcium-dependent phospholipase A2|phosphatidylcholine 2-acylhydrolase 5|phospholipase A2 group V|PLA2G5|phospholipase A2, Group V|PLA2|sPLA2|group V phospholipase A2|phospholipase A2|group 5|group V |
Gene, Accession # | Gene ID: 5322 |
Catalog # | ABIN633845 |
Price | $1020 |
Order / More Info | PLA2G5 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |