Edit |   |
---|---|
Antigenic Specificity | XRCC6 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-XRCC6 polyclonal antibody, unconjugated |
Immunogen | G22 P1 antibody was raised using the N terminal Of G22 1 corresponding to a region with amino acids MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFE |
Other Names | CTC75|CTCBF|G22P1|KU70|ML8|TLAA|5'-dRP lyase Ku70|5'-deoxyribose-5-phosphate lyase Ku70|70 kDa subunit of Ku antigen|ATP-dependent DNA helicase 2 subunit 1|ATP-dependent DNA helicase II 70 kDa subunit|ATP-dependent DNA helicase II|70 kDa subunit|CTC box binding factor 75 kDa subunit|CTC box-binding factor 75 kDa subunit|DNA repair protein XRCC6|Ku autoantigen p70 subunit|Ku autoantigen|70kDa|X-ray repair cross-complementing protein 6|lupus Ku autoantigen protein p70|thyroid autoantigen 70kD (Ku antigen)|thyroid autoantigen 70kDa (Ku antigen)|thyroid-lupus autoantigen p70|X-ray repair cross complementing 6|XRCC6|X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6|X-ray repair complementing defective repair in Chinese hamster cells 6 (Ku autoantigen|70kDa)|ATP-dependent DNA helicase II, 70 kDa subunit|Bm1_41430|X-ray repair complementing defective repair in Chinese hamster cells 6 L homeolog|xrcc6.L|5'-dRPAP lyase Ku70|Ku p70|ku autoantigen protein p70 homolog|thyroid autoantigen 70 kDa|Kup70|Ku70 DNA-binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa)|thyroid autoantigen|X-ray repair cross-complementing protein 5|wu:fi87b06|zgc:64131|Ku70 autoantigen |
Gene, Accession # | Gene ID: 2547 |
Catalog # | ABIN629623 |
Price | $902 |
Order / More Info | XRCC6 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |